Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Fgf23Fibroblast growth factor 23; FGF-23
Species
Rattus norvegicus (Rat)
Expression Region
25-251aa
Target Protein Sequence
YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
To produce recombinant Rat Fgf23 protein, a well-established recombinant DNA technology is the key. A DNA template of Fgf23 was constructed with N-terminal 6xHis tag using the technique. Once the template was made, the recombinant Rat Fgf23 protein could be produced with it efficiently. CUSABIO has built a strict QC system to ensure quality. The expression region is 25-251aa of the Rat Fgf23. The purity of this recombinant is 90% determined by SDS-PAGE.
FGF23 is a protein coding gene that encodes Fibroblast growth factor 23. According to some studies, FGF23 may have the following features.
FGF23 induces left ventricular hypertrophy. Targeted ablation of Fgf23 demonstrates an important physiological role of FGF23 in phosphate and vitamin D metabolism. FGF23 is a hormone that regulates phosphate metabolism—a unique biological feature of FGF23. Klotho converts the canonical FGF receptor into a specific receptor for FGF23. The rat parathyroid gland is a target organ of FGF23. Mutations in the FGF23 gene cause autosomal dominant hypophosphatemic rickets, possibly by preventing the proteolytic cleavage of FGF23 and enhancing its biological activity. Parathyroid hormone and FGF23 target the kidneys and cause phosphateuria. FGF23 also acts on the parathyroid glands to reduce PTH expression, but in chronic kidney disease.